PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG006800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 931aa    MW: 102081 Da    PI: 6.2879
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG006800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.92.1e-28583634152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+isle+l++yFs+++k+AAk Lgvc+T++KriCRq+GI+RWP+Rki+++
  Pavir.5KG006800.1.p 583 AEKSISLEVLQQYFSGSLKNAAKILGVCPTTMKRICRQHGISRWPSRKINKV 634
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.689573654IPR003035RWP-RK domain
PfamPF020423.1E-25587634IPR003035RWP-RK domain
SuperFamilySSF542771.41E-19826921No hitNo description
SMARTSM006665.4E-24836918IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.1E-24836917No hitNo description
PROSITE profilePS5174517.816836918IPR000270PB1 domain
PfamPF005642.1E-14836917IPR000270PB1 domain
CDDcd064077.83E-31837917No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MDLDPPTSGP GDACAVSADA WPFDSLTTSL LFSASPPLPP LPANSSWLTP PSPLWFFEDR  60
NLLPLDAPQA PEAAVAAAVV EEVQRARSGN SDSTSKRVEQ INHKWQFHLS LDEDGTDNSS  120
LFKERLTQAL RYFKESTNQH LLVQVWAPVK NGDRYVLTTS GQPFVLDHQS IGLLQYRAVS  180
MMYMFSVDGE NVGDLGLPGR VYKLKVPEWT PNVQYYSSTE YPRLNHAISY NVHGTVALPV  240
FDPSAQSCIA VVELIMTSKK INYACEVDKV CKALEAVNLK STEILDHPNV QICNEGRQTA  300
LVEILEILTV VCEEHKLPLA QTWVPCKYRS VLAHGGGLKK SCLSFDGSCM GEVCMSTSDV  360
AFHVIDAHMW GFRDACVEHH LQRGQGVSGK AFITRKPCFS KDIRKFCKLK YPLVHYARMF  420
GLAGCFAICL QSSYTGHDDY ILEFFLPPDC IDEHDQNALL ESIFTLMKQC LRSLKVVGDR  480
DSSGVSLQLS NVLKIENEEF KTDAQFDNSD GSLHDSPKGD THGAHTSDNR DNKVPNLPEG  540
HLMADDCSQD TGISAGRPNG SGASDSSVLH KTSKPPERRR GKAEKSISLE VLQQYFSGSL  600
KNAAKILGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKQVIESVQG SDAAFNLTSI  660
TGPLPIPVGP SSDSLNVEKV TQSKVAEPSN LVVDGDRDSS LQKSLENDGH FSILMAQQGF  720
IDNNNDSQLE ADKASHSRSS SGEGSINSRT SEGSCQGSPA NRTFVCKPIA STFAEPQLNP  780
EEFHKEHFQE PQLPLSRMLI EDSGSSKDLK NLFTPAADQP FLAPPSNLVS MKHSGTVTIK  840
ASFKEDIVRF RFPCSGSVTV LKDEVAKRLR MDAGTFDIKC LDDDHEWVKL ACNADLEECM  900
EISRNSGSHV IRLLVSDIAA HLGSSCGSSG *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.50840.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967359.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3XE990.0K3XE99_SETIT; Uncharacterized protein
STRINGSi000216m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein